PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA32765
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family BBR-BPC
Protein Properties Length: 300aa    MW: 33069 Da    PI: 10.4089
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA32765genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind345.41.3e-105132991301
                  GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdakirernlalsekkaavaerd.........maflqrdkalaernkal 74 
                                md d+  +  n+gyyep +s+k++lglqlm s++e+     ++ + ls++++++ +rd         m++ +rd+++++     
  Tp57577_TGAC_v2_mRNA32765  13 MDGDNGLNiSNWGYYEPVSSFKSHLGLQLMPSMPEKPLLGSHNAAVLSGSNGPFRNRDiglpqttypMDY-MRDAWISS----- 90 
                                8888888889************************998766555555************************.********..... PP

                  GAGA_bind  75 verdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakk 158
                                 +rdnk++++ ++ ++     p+g++++++++s++ +q+++ p+l      ++     e+ p+eea+ ++k + + kkrq +k+
  Tp57577_TGAC_v2_mRNA32765  91 -QRDNKYMNMNMIPTN-----PPGYSSIPEASSAHPIQMIRPPEL------VK-----EERPTEEAPVVEKSNGTGKKRQGPKV 157
                                .9********999886.....*****************9332222......22.....345666667777888888899999** PP

                  GAGA_bind 159 pkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvy 242
                                pk++kakk+k+ ++++k +++++s++++ +a+kk++++++ng++lD+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtt+iS+y
  Tp57577_TGAC_v2_mRNA32765 158 PKSPKAKKPKRGPRVPK-DENSPSVQRTPRAPKKTTEIAINGIDLDISSIPIPVCSCTGTPQQCYRWGSGGWQSACCTTAISIY 240
                                ***********888875.55666667899******************************************************* PP

                  GAGA_bind 243 PLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                                PLP+stkrrgaRiagrKmS gafkk+LekLaaeGy++snp+DL+++WAkHGtnkfvtir
  Tp57577_TGAC_v2_mRNA32765 241 PLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEGYNFSNPIDLRTYWAKHGTNKFVTIR 299
                                **********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062176.0E-10513299IPR010409GAGA-binding transcriptional activator
SMARTSM012265.1E-15613299IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
LKQKFSSTFS VVMDGDNGLN ISNWGYYEPV SSFKSHLGLQ LMPSMPEKPL LGSHNAAVLS  60
GSNGPFRNRD IGLPQTTYPM DYMRDAWISS QRDNKYMNMN MIPTNPPGYS SIPEASSAHP  120
IQMIRPPELV KEERPTEEAP VVEKSNGTGK KRQGPKVPKS PKAKKPKRGP RVPKDENSPS  180
VQRTPRAPKK TTEIAINGID LDISSIPIPV CSCTGTPQQC YRWGSGGWQS ACCTTAISIY  240
PLPMSTKRRG ARIAGRKMSI GAFKKVLEKL AAEGYNFSNP IDLRTYWAKH GTNKFVTIR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1427190.0BT142719.1 Medicago truncatula clone JCVI-FLMt-15C3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513328.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
RefseqXP_004513327.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD04e-92BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLI1L4051e-171I1L405_SOYBN; Uncharacterized protein
STRINGGLYMA09G30040.41e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.23e-86basic pentacysteine1